PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID GSMUA_Achr11P01790_001
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Zingiberales; Musaceae; Musa
Family TCP
Protein Properties Length: 244aa    MW: 24236.2 Da    PI: 10.4614
Description TCP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
GSMUA_Achr11P01790_001genomeCIRADView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1TCP123.42.4e-3834129289
                     TCP   2 agkkdrhskihTkvggRdRRvRlsaecaarfFdLqdeLGfdkdsktieWLlqqakpaikeltgtssssaseceaesssssasnsssg 88 
                             a+kk +++++h+kv+gR+RR+R+++ caar+F+L++eLG+++d++tieWLl+qa+p+i+++tgt++++as+++ +ss   +++ +sg
  GSMUA_Achr11P01790_001  34 AVKKPPSKDRHSKVDGRGRRIRMPIICAARVFQLTRELGHKSDGQTIEWLLRQAEPSIIAATGTGTTPASFSTVSSSLLRGAAGNSG 120
                             78*******************************************************************888555555555544444 PP

                     TCP  89 ........k 89 
                                      
  GSMUA_Achr11P01790_001 121 agaplslpT 129
                             333333331 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5136928.2094094IPR017887Transcription factor TCP subgroup
PfamPF036343.4E-3240117IPR005333Transcription factor, TCP
Sequence ? help Back to Top
Protein Sequence    Length: 244 aa     Download sequence    Send to blast
MSNPDGGTSG SGPLEGQKQQ QRQLAPAGGN GALAVKKPPS KDRHSKVDGR GRRIRMPIIC  60
AARVFQLTRE LGHKSDGQTI EWLLRQAEPS IIAATGTGTT PASFSTVSSS LLRGAAGNSG  120
AGAPLSLPTP SSSAAAVSGG KEDTVTGGVG GVSSGAGMGI GPAAGFWALP ARQDFGQVWS  180
FATPEMVPVT LNGRFAGQPM GEASAARVGN YLPLAGHLNL LASLSGAPGA AAAGAAAGTD  240
DEAR
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00524DAPTransfer from AT5G23280Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAK2407982e-77AK240798.1 Oryza sativa Japonica Group cDNA, clone: J065002G04, full insert sequence.
GenBankAP0047762e-77AP004776.3 Oryza sativa Japonica Group genomic DNA, chromosome 2, PAC clone:P0452F04.
GenBankAP0149582e-77AP014958.1 Oryza sativa Japonica Group DNA, chromosome 2, cultivar: Nipponbare, complete sequence.
GenBankCP0126102e-77CP012610.1 Oryza sativa Indica Group cultivar RP Bio-226 chromosome 2 sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_009382109.11e-139PREDICTED: transcription factor TCP21-like
SwissprotQ9FMX27e-70TCP7_ARATH; Transcription factor TCP7
TrEMBLM0RNK91e-172M0RNK9_MUSAM; Uncharacterized protein
STRINGGSMUA_Achr11P01790_0011e-172(Musa acuminata)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP194133100
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G23280.15e-47TCP family protein